Lineage for d2qypb2 (2qyp B:1-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2716978Family a.64.1.1: NKL-like [47863] (4 proteins)
  6. 2716985Protein Saposin C [89077] (1 species)
  7. 2716986Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries)
  8. 2716995Domain d2qypb2: 2qyp B:1-78 [151478]
    Other proteins in same PDB: d2qypb3
    automated match to d1m12a_

Details for d2qypb2

PDB Entry: 2qyp (more details), 2.45 Å

PDB Description: Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation
PDB Compounds: (B:) Proactivator polypeptide

SCOPe Domain Sequences for d2qypb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qypb2 a.64.1.1 (B:1-78) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
sdvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssils
illeevspelvcsmlhlc

SCOPe Domain Coordinates for d2qypb2:

Click to download the PDB-style file with coordinates for d2qypb2.
(The format of our PDB-style files is described here.)

Timeline for d2qypb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qypb3
View in 3D
Domains from other chains:
(mouse over for more information)
d2qypa_