SCOP 1.75: Domain d2qyic1: 2qyi C:316-545

Lineage for d2qyic1 (2qyi C:316-545)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (279 PDB entries)
   Uniprot P00760

8. Domain d2qyic1: 2qyi C:316-545 [151472]
   automatically matched to d1tgsz_
   complexed with ca, ni; mutant

Details for d2qyic1

PDB Entry: 2qyi, 2.6 Å

PDB Description: crystal structure of a binary complex between an engineered trypsin inhibitor and bovine trypsin

PDB Compounds: (C:) cationic trypsin

SCOP Domain Sequences for d2qyic1:

Sequence; same for both SEQRES and ATOM records:

>d2qyic1 b.47.1.2 (C:316-545) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2qyic1:

• d2qyic1 is new in SCOP 1.75
  
• d2qyic1 is called d2qyic_ in SCOPe 2.01
  
• d2qyic1 appears in the current release, SCOPe 2.08, called d2qyic_