SCOPe 2.07: Domain d1myfa_: 1myf A:

Lineage for d1myfa_ (1myf A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
   Uniprot P02185

8. Domain d1myfa_: 1myf A: [15147]
   complexed with cmo, hem

Details for d1myfa_

PDB Entry: 1myf

PDB Description: solution structure of carbonmonoxy myoglobin determined from nmr distance and chemical shift constraints

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1myfa_:

Sequence; same for both SEQRES and ATOM records:

>d1myfa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1myfa_:

• d1myfa_ first appeared (with stable ids) in SCOP 1.55, called d1myf__
  
• d1myfa_ appears in SCOPe 2.06
  
• d1myfa_ appears in the current release, SCOPe 2.08