![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
![]() | Protein automated matches [190438] (36 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187421] (100 PDB entries) |
![]() | Domain d2qy0d_: 2qy0 D: [151468] Other proteins in same PDB: d2qy0a1, d2qy0a2, d2qy0a3, d2qy0c1, d2qy0c2, d2qy0c3 automated match to d2qxia_ complexed with gol |
PDB Entry: 2qy0 (more details), 2.6 Å
SCOPe Domain Sequences for d2qy0d_:
Sequence, based on SEQRES records: (download)
>d2qy0d_ b.47.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheaqsnasldvflgh tnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndt fydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghp slkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee
>d2qy0d_ b.47.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehsnasldvflghtnv eelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndtfyd lglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslk qdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee
Timeline for d2qy0d_: