Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins) Common fold covers whole protein structure |
Protein Aldose reductase (aldehyde reductase) [51436] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [51437] (57 PDB entries) Uniprot P15121 |
Domain d2qxwa1: 2qxw A:2-312 [151466] automatically matched to d1pwla_ complexed with cit, ldt, ndp |
PDB Entry: 2qxw (more details), 0.8 Å
SCOP Domain Sequences for d2qxwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qxwa1 c.1.7.1 (A:2-312) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} srillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqek lreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgkef fpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpav nqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakhn kttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcall sctshkdypfh
Timeline for d2qxwa1: