Lineage for d2qxug1 (2qxu G:3-181)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842512Family c.69.1.18: Bacterial lipase [53570] (3 proteins)
    lack the first two strands of the common fold
  6. 842536Protein Lipase A [64145] (1 species)
    minimal alpha/beta hydrolase fold;
  7. 842537Species Bacillus subtilis [TaxId:1423] [64146] (8 PDB entries)
    Uniprot P37957 34-212
  8. 842552Domain d2qxug1: 2qxu G:3-181 [151464]
    automatically matched to d1i6wb_

Details for d2qxug1

PDB Entry: 2qxu (more details), 1.9 Å

PDB Description: crystal structure analysis of the bacillus subtilis lipase crystallized at ph 5.0
PDB Compounds: (G:) Lipase

SCOP Domain Sequences for d2qxug1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qxug1 c.69.1.18 (G:3-181) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn

SCOP Domain Coordinates for d2qxug1:

Click to download the PDB-style file with coordinates for d2qxug1.
(The format of our PDB-style files is described here.)

Timeline for d2qxug1: