SCOP 1.75: Domain d2qxuf1: 2qxu F:3-181

Lineage for d2qxuf1 (2qxu F:3-181)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (3 proteins)
   lack the first two strands of the common fold

6. Protein Lipase A [64145] (1 species)
   minimal alpha/beta hydrolase fold;

7. Species Bacillus subtilis [TaxId:1423] [64146] (8 PDB entries)
   Uniprot P37957 34-212

8. Domain d2qxuf1: 2qxu F:3-181 [151463]
   automatically matched to d1i6wb_

Details for d2qxuf1

PDB Entry: 2qxu, 1.9 Å

PDB Description: crystal structure analysis of the bacillus subtilis lipase crystallized at ph 5.0

PDB Compounds: (F:) Lipase

SCOP Domain Sequences for d2qxuf1:

Sequence; same for both SEQRES and ATOM records:

>d2qxuf1 c.69.1.18 (F:3-181) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn

Timeline for d2qxuf1:

• d2qxuf1 is new in SCOP 1.75
  
• d2qxuf1 is called d2qxuf_ in SCOPe 2.01
  
• d2qxuf1 appears in the current release, SCOPe 2.08, called d2qxuf_