| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
| Protein Lipase A [64145] (4 species) minimal alpha/beta hydrolase fold; |
| Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries) Uniprot P37957 34-212 |
| Domain d2qxuf_: 2qxu F: [151463] automated match to d1i6wa_ |
PDB Entry: 2qxu (more details), 1.9 Å
SCOPe Domain Sequences for d2qxuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qxuf_ c.69.1.18 (F:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn
Timeline for d2qxuf_: