SCOPe 2.05: Domain d2qxue_: 2qxu E:

Lineage for d2qxue_ (2qxu E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein Lipase A [64145] (3 species)
   minimal alpha/beta hydrolase fold;

7. Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
   Uniprot P37957 34-212

8. Domain d2qxue_: 2qxu E: [151462]
   automated match to d1i6wa_

Details for d2qxue_

PDB Entry: 2qxu, 1.9 Å

PDB Description: crystal structure analysis of the bacillus subtilis lipase crystallized at ph 5.0

PDB Compounds: (E:) Lipase

SCOPe Domain Sequences for d2qxue_:

Sequence; same for both SEQRES and ATOM records:

>d2qxue_ c.69.1.18 (E:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn

Timeline for d2qxue_:

• d2qxue_ first appeared in SCOP 1.75, called d2qxue1
  
• d2qxue_ appears in SCOPe 2.04
  
• d2qxue_ appears in SCOPe 2.06
  
• d2qxue_ appears in the current release, SCOPe 2.08