Lineage for d1mbna_ (1mbn A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903195Protein Myoglobin [46469] (9 species)
  7. 903301Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (225 PDB entries)
    Uniprot P02185
  8. 903523Domain d1mbna_: 1mbn A: [15146]
    complexed with hem, oh

Details for d1mbna_

PDB Entry: 1mbn (more details), 2 Å

PDB Description: the stereochemistry of the protein myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1mbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbna_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1mbna_:

Click to download the PDB-style file with coordinates for d1mbna_.
(The format of our PDB-style files is described here.)

Timeline for d1mbna_: