SCOPe 2.06: Domain d2qxtb_: 2qxt B:

Lineage for d2qxtb_ (2qxt B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein Lipase A [64145] (3 species)
   minimal alpha/beta hydrolase fold;

7. Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
   Uniprot P37957 34-212

8. Domain d2qxtb_: 2qxt B: [151457]
   automated match to d1i6wa_

Details for d2qxtb_

PDB Entry: 2qxt, 2 Å

PDB Description: crystal structure analysis of the bacillus subtilis lipase crystallized at ph 4.5

PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d2qxtb_:

Sequence; same for both SEQRES and ATOM records:

>d2qxtb_ c.69.1.18 (B:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn

Timeline for d2qxtb_:

• d2qxtb_ first appeared in SCOP 1.75, called d2qxtb1
  
• d2qxtb_ appears in SCOPe 2.05
  
• d2qxtb_ appears in SCOPe 2.07
  
• d2qxtb_ appears in the current release, SCOPe 2.08