Lineage for d2qxfa_ (2qxf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124334Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 protein domains)
    contains Pfam PF00929
  6. 2124644Protein Exonuclease I [53132] (2 species)
    also includes an alpha+beta domain with SH3-like like motif and non-globular C-terminal all-alpha region
  7. 2124645Species Escherichia coli K-12 [TaxId:83333] [159630] (3 PDB entries)
  8. 2124646Domain d2qxfa_: 2qxf A: [151455]
    automated match to d1fxxa_
    complexed with mg, na, tmp

Details for d2qxfa_

PDB Entry: 2qxf (more details), 1.5 Å

PDB Description: product bound structure of exonuclease i at 1.5 angstrom resolution
PDB Compounds: (A:) Exodeoxyribonuclease I

SCOPe Domain Sequences for d2qxfa_:

Sequence, based on SEQRES records: (download)

>d2qxfa_ c.55.3.5 (A:) Exonuclease I {Escherichia coli K-12 [TaxId: 83333]}
qqstflfhdyetfgthpaldrpaqfaairtdsefnvigepevfyckpaddylpqpgavli
tgitpqearakgeneaafaarihslftvpktcilgynnvrfddevtrnifyrnfydpyaw
swqhdnsrwdlldvmracyalrpeginwpenddglpsfrlehltkangiehsnahdamad
vyatiamaklvktrqprlfdylfthrnkhklmalidvpqmkplvhvsgmfgawrgntswv
aplawhpenrnavimvdlagdisplleldsdtlrerlytaktdlgdnaavpvklvhinkc
pvlaqantlrpedadrlginrqhcldnlkilrenpqvrekvvaifaeaepftpsdnvdaq
lyngffsdadraamkivleteprnlpalditfvdkriekllfnyrarnfpgtldyaeqqr
wlehrrqvftpeflqgyadelqmlvqqyaddkekvallkalwqyadei

Sequence, based on observed residues (ATOM records): (download)

>d2qxfa_ c.55.3.5 (A:) Exonuclease I {Escherichia coli K-12 [TaxId: 83333]}
qqstflfhdyetfgthpaldrpaqfaairtdsefnvigepevfyckpaddylpqpgavli
tgitpqearakgeneaafaarihslftvpktcilgynnvrfddevtrnifyrnfydpyaw
swqhdnsrwdlldvmracyalrpeginwpenddglpsfrlehltkangiehsdamadvya
tiamaklvktrqprlfdylfthrnkhklmalidvpqmkplvhvsgmfgawrgntswvapl
awhpenrnavimvdlagdisplleldavpvklvhinkcpvlaqantlrpedadrlginrq
hcldnlkilrenpqvrekvdnvdaqlyngffsdadraamkivleteprnlpalditfvdk
riekllfnyrarnfpgtldyaeqqrwlehrrqvftpeflqgyadelqmlvqqyaddkekv
allkalwqyadei

SCOPe Domain Coordinates for d2qxfa_:

Click to download the PDB-style file with coordinates for d2qxfa_.
(The format of our PDB-style files is described here.)

Timeline for d2qxfa_: