| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
| Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries) |
| Domain d2qx6b_: 2qx6 B: [151450] automated match to d1qr2a_ complexed with fad, ml1, zn |
PDB Entry: 2qx6 (more details), 1.75 Å
SCOPe Domain Sequences for d2qx6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qx6b_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
Timeline for d2qx6b_: