SCOP 1.73: Domain d1vxba_: 1vxb A:

Lineage for d1vxba_ (1vxb A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)

8. Domain d1vxba_: 1vxb A: [15145]
   complexed with hem, mto, so4

Details for d1vxba_

PDB Entry: 1vxb, 2 Å

PDB Description: native sperm whale myoglobin

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1vxba_:

Sequence; same for both SEQRES and ATOM records:

>d1vxba_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1vxba_:

• d1vxba_ first appeared (with stable ids) in SCOP 1.55, called d1vxb__
  
• d1vxba_ was called d1vxb__ in SCOP 1.71
  
• d1vxba_ appears in SCOP 1.75
  
• d1vxba_ appears in the current release, SCOPe 2.08