Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
Protein Ketoacyl-ACP synthase III (FabH) [53912] (4 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries) |
Domain d2qx1a1: 2qx1 A:-10-174 [151443] automated match to d1hzpa1 complexed with coa, d1t |
PDB Entry: 2qx1 (more details), 2.6 Å
SCOPe Domain Sequences for d2qx1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qx1a1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp fqgi
Timeline for d2qx1a1: