Lineage for d2qwvb2 (2qwv B:5-205)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150174Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2150175Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2150303Family c.116.1.7: AF1056-like [159518] (2 protein domains)
    Pfam PF04013; DUF358
  6. 2150308Protein Uncharacterized protein VCA1059 [159521] (1 species)
  7. 2150309Species Vibrio cholerae [TaxId:666] [159522] (1 PDB entry)
    Uniprot Q9KKP3 1-201
  8. 2150311Domain d2qwvb2: 2qwv B:5-205 [151440]
    Other proteins in same PDB: d2qwva2, d2qwvb3
    automated match to d2qwva1
    complexed with acy

Details for d2qwvb2

PDB Entry: 2qwv (more details), 2.6 Å

PDB Description: Crystal structure of unknown function protein VCA1059
PDB Compounds: (B:) UPF0217 protein VC_A1059

SCOPe Domain Sequences for d2qwvb2:

Sequence, based on SEQRES records: (download)

>d2qwvb2 c.116.1.7 (B:5-205) Uncharacterized protein VCA1059 {Vibrio cholerae [TaxId: 666]}
mrsfilrarsaptdsqrlldeiggkchteilahcmmnslftaqshredvvihlvlestrd
ysrtitveaneisdvggfheaaliallvkaldasvgmgkeqtrvvqpgltvrtisfeall
gelaehhslymmdkkgdsirdikigpnpcfiltdhipmpkksgnsmkrlgvekislgpkm
lfasqcvtlihneidhqeagw

Sequence, based on observed residues (ATOM records): (download)

>d2qwvb2 c.116.1.7 (B:5-205) Uncharacterized protein VCA1059 {Vibrio cholerae [TaxId: 666]}
mrsfilrarsaptdsqrlldeiggkchteilahcmmnslftaqshredvvihlvlestrd
ysrtitveaneisgfheaaliallvkaldasvgmgkeqtrvvqpgltvrtisfeallgel
aehhslymmdkkgdsirdikigpnpcfiltdhnsmkrlgvekislgpkmlfasqcvtlih
neidhqeagw

SCOPe Domain Coordinates for d2qwvb2:

Click to download the PDB-style file with coordinates for d2qwvb2.
(The format of our PDB-style files is described here.)

Timeline for d2qwvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qwvb3