Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries) |
Domain d2qwra1: 2qwr A:4-188 [151436] Other proteins in same PDB: d2qwrb_ automated match to d1atra1 complexed with acy, anp, gol |
PDB Entry: 2qwr (more details), 2.21 Å
SCOPe Domain Sequences for d2qwra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qwra1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlciineptaaaiay gldkk
Timeline for d2qwra1: