SCOP 1.69: Domain d1duka_: 1duk A:

Lineage for d1duka_ (1duk A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)

8. Domain d1duka_: 1duk A: [15143]

Details for d1duka_

PDB Entry: 1duk, 2.13 Å

PDB Description: wild-type recombinant sperm whale metaquomyoglobin

SCOP Domain Sequences for d1duka_:

Sequence; same for both SEQRES and ATOM records:

>d1duka_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyq

Timeline for d1duka_:

• d1duka_ first appeared (with stable ids) in SCOP 1.55
  
• d1duka_ appears in SCOP 1.67
  
• d1duka_ appears in SCOP 1.71
  
• d1duka_ appears in the current release, SCOPe 2.08