Lineage for d2qwnb1 (2qwn B:812-905)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1470423Fold i.23: clathrin assemblies [111484] (1 superfamily)
  4. 1470424Superfamily i.23.1: clathrin assemblies [111485] (1 family) (S)
  5. 1470425Family i.23.1.1: clathrin assemblies [111486] (2 proteins)
  6. 1470452Protein Clathrin D6 coat [118381] (1 species)
  7. 1470453Species Cow (Bos taurus) [TaxId:9913] [118382] (3 PDB entries)
  8. 1470454Domain d2qwnb1: 2qwn B:812-905 [151429]
    Other proteins in same PDB: d2qwna1, d2qwna2
    automatically matched to d1xi5j_
    complexed with adp, mg, na, po4

Details for d2qwnb1

PDB Entry: 2qwn (more details), 2.4 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi state
PDB Compounds: (B:) Putative tyrosine-protein phosphatase auxilin

SCOPe Domain Sequences for d2qwnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qwnb1 i.23.1.1 (B:812-905) Clathrin D6 coat {Cow (Bos taurus) [TaxId: 9913]}
mdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavl
vvhpckatgqpyeqyakmifmelndawsefenqg

SCOPe Domain Coordinates for d2qwnb1:

Click to download the PDB-style file with coordinates for d2qwnb1.
(The format of our PDB-style files is described here.)

Timeline for d2qwnb1: