SCOPe 2.03: Domain d2qwnb1: 2qwn B:812-905

Lineage for d2qwnb1 (2qwn B:812-905)

1. Root: SCOPe 2.03

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.23: clathrin assemblies [111484] (1 superfamily)

4. Superfamily i.23.1: clathrin assemblies [111485] (1 family)

5. Family i.23.1.1: clathrin assemblies [111486] (2 proteins)

6. Protein Clathrin D6 coat [118381] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [118382] (3 PDB entries)

8. Domain d2qwnb1: 2qwn B:812-905 [151429]
   Other proteins in same PDB: d2qwna1, d2qwna2
   automatically matched to d1xi5j_
   complexed with adp, mg, na, po4

Details for d2qwnb1

PDB Entry: 2qwn, 2.4 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi state

PDB Compounds: (B:) Putative tyrosine-protein phosphatase auxilin

SCOPe Domain Sequences for d2qwnb1:

Sequence; same for both SEQRES and ATOM records:

>d2qwnb1 i.23.1.1 (B:812-905) Clathrin D6 coat {Cow (Bos taurus) [TaxId: 9913]}
mdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavl
vvhpckatgqpyeqyakmifmelndawsefenqg

Timeline for d2qwnb1:

• d2qwnb1 first appeared in SCOP 1.75
  
• d2qwnb1 appears in SCOPe 2.02
  
• d2qwnb1 is called d2qwnb_ in SCOPe 2.04
  
• d2qwnb1 appears in the current release, SCOPe 2.08, called d2qwnb_