Lineage for d108ma_ (108m A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717376Protein Myoglobin [46469] (9 species)
  7. 1717514Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (245 PDB entries)
    Uniprot P02185
  8. 1717750Domain d108ma_: 108m A: [15142]
    complexed with hem, nbn, so4

Details for d108ma_

PDB Entry: 108m (more details), 2.67 Å

PDB Description: sperm whale myoglobin v68f n-butyl isocyanide at ph 7.0
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d108ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d108ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtfltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d108ma_:

Click to download the PDB-style file with coordinates for d108ma_.
(The format of our PDB-style files is described here.)

Timeline for d108ma_: