Lineage for d2qw7h_ (2qw7 H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1790346Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) (S)
    homohexameric unit
  5. 1790347Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
    Pfam PF03319
  6. 1790348Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species)
  7. 1790380Species Synechocystis sp. PCC 6803 [TaxId:1148] [159140] (1 PDB entry)
    Uniprot P72759 1-96
  8. 1790388Domain d2qw7h_: 2qw7 H: [151412]
    automated match to d2qw7a1
    complexed with gol

Details for d2qw7h_

PDB Entry: 2qw7 (more details), 2.4 Å

PDB Description: Carboxysome Subunit, CcmL
PDB Compounds: (H:) Carbon dioxide concentrating mechanism protein ccmL

SCOPe Domain Sequences for d2qw7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qw7h_ b.40.15.1 (H:) Carbon dioxide concentrating mechanism protein CcmL {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mqlakvlgtvvstsktpnltgvklllvqfldtkgqpleryevagdvvgaglnewvlvarg
saarkergngdrpldamvvgiidtvnvasgslynkrdd

SCOPe Domain Coordinates for d2qw7h_:

Click to download the PDB-style file with coordinates for d2qw7h_.
(The format of our PDB-style files is described here.)

Timeline for d2qw7h_: