Lineage for d2qw7c_ (2qw7 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791232Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) (S)
    homohexameric unit
  5. 2791233Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
    Pfam PF03319
  6. 2791234Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species)
  7. 2791266Species Synechocystis sp. PCC 6803 [TaxId:1148] [159140] (1 PDB entry)
    Uniprot P72759 1-96
  8. 2791269Domain d2qw7c_: 2qw7 C: [151407]
    automated match to d2qw7a1
    complexed with gol

Details for d2qw7c_

PDB Entry: 2qw7 (more details), 2.4 Å

PDB Description: Carboxysome Subunit, CcmL
PDB Compounds: (C:) Carbon dioxide concentrating mechanism protein ccmL

SCOPe Domain Sequences for d2qw7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qw7c_ b.40.15.1 (C:) Carbon dioxide concentrating mechanism protein CcmL {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mqlakvlgtvvstsktpnltgvklllvqfldtkgqpleryevagdvvgaglnewvlvarg
saarkergngdrpldamvvgiidtvnvasgslynk

SCOPe Domain Coordinates for d2qw7c_:

Click to download the PDB-style file with coordinates for d2qw7c_.
(The format of our PDB-style files is described here.)

Timeline for d2qw7c_: