![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) ![]() homohexameric unit |
![]() | Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins) Pfam PF03319 |
![]() | Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species) |
![]() | Species Synechocystis sp. PCC 6803 [TaxId:1148] [159140] (1 PDB entry) Uniprot P72759 1-96 |
![]() | Domain d2qw7c_: 2qw7 C: [151407] automated match to d2qw7a1 complexed with gol |
PDB Entry: 2qw7 (more details), 2.4 Å
SCOPe Domain Sequences for d2qw7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qw7c_ b.40.15.1 (C:) Carbon dioxide concentrating mechanism protein CcmL {Synechocystis sp. PCC 6803 [TaxId: 1148]} mqlakvlgtvvstsktpnltgvklllvqfldtkgqpleryevagdvvgaglnewvlvarg saarkergngdrpldamvvgiidtvnvasgslynk
Timeline for d2qw7c_: