Lineage for d2qw7a1 (2qw7 A:1-96)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 800617Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) (S)
    homohexameric unit
  5. 800618Family b.40.15.1: EutN/CcmL-like [159134] (3 proteins)
    Pfam PF03319
  6. 800619Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (1 species)
  7. 800620Species Synechocystis sp. (strain PCC 6803) [TaxId:1148] [159140] (1 PDB entry)
    Uniprot P72759 1-96
  8. 800621Domain d2qw7a1: 2qw7 A:1-96 [151405]
    complexed with gol

Details for d2qw7a1

PDB Entry: 2qw7 (more details), 2.4 Å

PDB Description: Carboxysome Subunit, CcmL
PDB Compounds: (A:) Carbon dioxide concentrating mechanism protein ccmL

SCOP Domain Sequences for d2qw7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qw7a1 b.40.15.1 (A:1-96) Carbon dioxide concentrating mechanism protein CcmL {Synechocystis sp. (strain PCC 6803) [TaxId: 1148]}
mqlakvlgtvvstsktpnltgvklllvqfldtkgqpleryevagdvvgaglnewvlvarg
saarkergngdrpldamvvgiidtvnvasgslynkr

SCOP Domain Coordinates for d2qw7a1:

Click to download the PDB-style file with coordinates for d2qw7a1.
(The format of our PDB-style files is described here.)

Timeline for d2qw7a1: