Lineage for d2qw4d1 (2qw4 D:32-264)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776730Protein Orphan nuclear receptor NR4A1 [158811] (1 species)
  7. 776731Species Human (Homo sapiens) [TaxId:9606] [158812] (1 PDB entry)
    Uniprot P22736 363-595
  8. 776735Domain d2qw4d1: 2qw4 D:32-264 [151400]
    automatically matched to 2QW4 A:32-264

Details for d2qw4d1

PDB Entry: 2qw4 (more details), 2.8 Å

PDB Description: Human NR4A1 ligand-binding domain
PDB Compounds: (D:) Orphan nuclear receptor NR4A1

SCOP Domain Sequences for d2qw4d1:

Sequence, based on SEQRES records: (download)

>d2qw4d1 a.123.1.1 (D:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
nlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkwae
kipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgdw
idsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaav
agepqpasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdt

Sequence, based on observed residues (ATOM records): (download)

>d2qw4d1 a.123.1.1 (D:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
nlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkwae
kipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgdw
idsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaav
sclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdt

SCOP Domain Coordinates for d2qw4d1:

Click to download the PDB-style file with coordinates for d2qw4d1.
(The format of our PDB-style files is described here.)

Timeline for d2qw4d1: