Lineage for d1dtma_ (1dtm A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1076387Protein Myoglobin [46469] (9 species)
  7. 1076503Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (229 PDB entries)
    Uniprot P02185
  8. 1076723Domain d1dtma_: 1dtm A: [15140]
    complexed with 4mz, hem; mutant

Details for d1dtma_

PDB Entry: 1dtm (more details), 2.13 Å

PDB Description: crystal structure of the sperm-whale myoglobin mutant h93g complexed with 4-methylimidazole, metaquo form
PDB Compounds: (A:) recombinant sperm whale myoglobin variant h93g

SCOPe Domain Sequences for d1dtma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyq

SCOPe Domain Coordinates for d1dtma_:

Click to download the PDB-style file with coordinates for d1dtma_.
(The format of our PDB-style files is described here.)

Timeline for d1dtma_: