Lineage for d2qw4c_ (2qw4 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008847Protein Orphan nuclear receptor NR4A1 [158811] (1 species)
  7. 2008848Species Human (Homo sapiens) [TaxId:9606] [158812] (15 PDB entries)
    Uniprot P22736 363-595
  8. 2008873Domain d2qw4c_: 2qw4 C: [151399]
    automated match to d2qw4a1

Details for d2qw4c_

PDB Entry: 2qw4 (more details), 2.8 Å

PDB Description: Human NR4A1 ligand-binding domain
PDB Compounds: (C:) Orphan nuclear receptor NR4A1

SCOPe Domain Sequences for d2qw4c_:

Sequence, based on SEQRES records: (download)

>d2qw4c_ a.123.1.1 (C:) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
panlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkw
aekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfg
dwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehva
avagepqpasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdt

Sequence, based on observed residues (ATOM records): (download)

>d2qw4c_ a.123.1.1 (C:) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
panlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkw
aekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfg
dwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehva
avclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdt

SCOPe Domain Coordinates for d2qw4c_:

Click to download the PDB-style file with coordinates for d2qw4c_.
(The format of our PDB-style files is described here.)

Timeline for d2qw4c_: