SCOP 1.75: Domain d2qvvb1: 2qvv B:9-337

Lineage for d2qvvb1 (2qvv B:9-337)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
   N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet

4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (2 families)

5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (6 proteins)

6. Protein Fructose-1,6-bisphosphatase [56657] (5 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56658] (51 PDB entries)

8. Domain d2qvvb1: 2qvv B:9-337 [151395]
   automatically matched to d1cnqa_
   complexed with fdp, po4, zn

Details for d2qvvb1

PDB Entry: 2qvv, 2.03 Å

PDB Description: porcine liver fructose-1,6-bisphosphatase cocrystallized with fru-2,6- p2 and zn2+, i(t)-state

PDB Compounds: (B:) Fructose-1,6-bisphosphatase 1

SCOP Domain Sequences for d2qvvb1:

Sequence; same for both SEQRES and ATOM records:

>d2qvvb1 e.7.1.1 (B:9-337) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
nivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgd
qvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidc
lvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldp
aigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsm
vadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivpt
dihqrapiilgspedvtelleiyqkhaak

Timeline for d2qvvb1:

• d2qvvb1 is new in SCOP 1.75
  
• d2qvvb1 is called d2qvvb_ in SCOPe 2.01
  
• d2qvvb1 appears in the current release, SCOPe 2.08, called d2qvvb_