Lineage for d2qvia2 (2qvi A:102-215)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.6: Cadherin-like [49313] (3 families) 
Family b.1.6.1: Cadherin [49314] (4 proteins) 
Protein N-cadherin (neural) [49315] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries) 
Domain d2qvia2: 2qvi A:102-215 [151389]
automatically matched to d1ncja2
complexed with ca
Details for d2qvia2
PDB Entry: 2qvi (more details), 3.01 Å
PDB Description: crystal structure of n-cadherin domains ec12
PDB Compounds: (A:) Cadherin-2SCOPe Domain Sequences for d2qvia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qvia2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeflhqvwngsvpegskpgtyvmtvtaidaddpnalngmlryrilsqapstpspnm
ftinnetgdiitvaagldrekvqqytliiqatdmegnptyglsntatavitvtd
SCOPe Domain Coordinates for d2qvia2:
Click to download the PDB-style file with coordinates for d2qvia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qvia2:
- d2qvia2 first appeared in SCOP 1.75
- d2qvia2 appears in SCOPe 2.06
- d2qvia2 appears in the current release, SCOPe 2.08
View in 3D
