Lineage for d2qvia2 (2qvi A:102-215)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037193Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2037271Protein N-cadherin (neural) [49315] (1 species)
  7. 2037272Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)
  8. 2037281Domain d2qvia2: 2qvi A:102-215 [151389]
    automatically matched to d1ncja2
    complexed with ca

Details for d2qvia2

PDB Entry: 2qvi (more details), 3.01 Å

PDB Description: crystal structure of n-cadherin domains ec12
PDB Compounds: (A:) Cadherin-2

SCOPe Domain Sequences for d2qvia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qvia2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeflhqvwngsvpegskpgtyvmtvtaidaddpnalngmlryrilsqapstpspnm
ftinnetgdiitvaagldrekvqqytliiqatdmegnptyglsntatavitvtd

SCOPe Domain Coordinates for d2qvia2:

Click to download the PDB-style file with coordinates for d2qvia2.
(The format of our PDB-style files is described here.)

Timeline for d2qvia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qvia1