![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
![]() | Family b.1.6.1: Cadherin [49314] (4 proteins) |
![]() | Protein N-cadherin (neural) [49315] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries) |
![]() | Domain d2qvia2: 2qvi A:102-215 [151389] automatically matched to d1ncja2 complexed with ca |
PDB Entry: 2qvi (more details), 3.01 Å
SCOPe Domain Sequences for d2qvia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qvia2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} ndnrpeflhqvwngsvpegskpgtyvmtvtaidaddpnalngmlryrilsqapstpspnm ftinnetgdiitvaagldrekvqqytliiqatdmegnptyglsntatavitvtd
Timeline for d2qvia2: