Lineage for d2qvia1 (2qvi A:2-101)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373405Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2373406Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2373484Protein N-cadherin (neural) [49315] (1 species)
  7. 2373485Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)
  8. 2373493Domain d2qvia1: 2qvi A:2-101 [151388]
    automatically matched to d1ncja1
    complexed with ca

Details for d2qvia1

PDB Entry: 2qvi (more details), 3.01 Å

PDB Description: crystal structure of n-cadherin domains ec12
PDB Compounds: (A:) Cadherin-2

SCOPe Domain Sequences for d2qvia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qvia1 b.1.6.1 (A:2-101) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
wvippinlpensrgpfpqelvrirsdrdknlslrysvtgpgadqpptgifiinpisgqls
vtkpldreliarfhlrahavdingnqvenpidivinvidm

SCOPe Domain Coordinates for d2qvia1:

Click to download the PDB-style file with coordinates for d2qvia1.
(The format of our PDB-style files is described here.)

Timeline for d2qvia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qvia2