Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) |
Family b.1.6.1: Cadherin [49314] (4 proteins) |
Protein N-cadherin (neural) [49315] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries) |
Domain d2qvia1: 2qvi A:2-101 [151388] automatically matched to d1ncja1 complexed with ca |
PDB Entry: 2qvi (more details), 3.01 Å
SCOPe Domain Sequences for d2qvia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qvia1 b.1.6.1 (A:2-101) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} wvippinlpensrgpfpqelvrirsdrdknlslrysvtgpgadqpptgifiinpisgqls vtkpldreliarfhlrahavdingnqvenpidivinvidm
Timeline for d2qvia1: