Lineage for d2mb5a_ (2mb5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688020Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
    Uniprot P02185
  8. 2688244Domain d2mb5a_: 2mb5 A: [15138]
    complexed with cmo, dod, hem, nd4, so4

Details for d2mb5a_

PDB Entry: 2mb5 (more details), 1.8 Å

PDB Description: hydration in protein crystals. a neutron diffraction analysis of carbonmonoxymyoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2mb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mb5a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d2mb5a_:

Click to download the PDB-style file with coordinates for d2mb5a_.
(The format of our PDB-style files is described here.)

Timeline for d2mb5a_: