Lineage for d2quha1 (2quh A:97-469)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827433Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 827434Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 827435Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 827529Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
    overall structure is similar to TyrRS
  7. 827555Species Human (Homo sapiens) [TaxId:9606] [102256] (11 PDB entries)
    Uniprot P23381 94-471
  8. 827562Domain d2quha1: 2quh A:97-469 [151369]
    automatically matched to d1ulhb_
    complexed with trp

Details for d2quha1

PDB Entry: 2quh (more details), 2.4 Å

PDB Description: Crystal structures of human tryptophanyl-tRNA synthetase in complex with Trp
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOP Domain Sequences for d2quha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quha1 c.26.1.1 (A:97-469) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyav
enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
stffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdv
dvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdei
vkefmtprklsfd

SCOP Domain Coordinates for d2quha1:

Click to download the PDB-style file with coordinates for d2quha1.
(The format of our PDB-style files is described here.)

Timeline for d2quha1: