SCOP 1.75: Domain d2qtvb1: 2qtv B:24-189

Lineage for d2qtvb1 (2qtv B:24-189)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein SAR1 [69483] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82403] (2 PDB entries)

8. Domain d2qtvb1: 2qtv B:24-189 [151362]
   Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva3, d2qtva4, d2qtva5
   automatically matched to d1m2ob_
   complexed with gnp, mg, zn

Details for d2qtvb1

PDB Entry: 2qtv, 2.5 Å

PDB Description: structure of sec23-sar1 complexed with the active fragment of sec31

PDB Compounds: (B:) Small COPII coat GTPase SAR1

SCOP Domain Sequences for d2qtvb1:

Sequence, based on SEQRES records:

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarrl
wkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavsea
elrsalgllnttgsqriegqrpvevfmcsvvmrngyleafqwlsqy

Sequence, based on observed residues (ATOM records):

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarrl
wkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavsea
elrsalgllnttgiegqrpvevfmcsvvmrngyleafqwlsqy

Timeline for d2qtvb1:

• d2qtvb1 is new in SCOP 1.75
  
• d2qtvb1 is called d2qtvb_ in SCOPe 2.01
  
• d2qtvb1 appears in the current release, SCOPe 2.08, called d2qtvb_