Lineage for d2qtva5 (2qtv A:45-119)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263854Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) (S)
  5. 2263855Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)
  6. 2263856Protein Sec23 [82921] (1 species)
  7. 2263857Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82922] (3 PDB entries)
  8. 2263858Domain d2qtva5: 2qtv A:45-119 [151361]
    Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva3, d2qtva4, d2qtvb_
    automatically matched to d1m2oa5
    complexed with gnp, mg, zn

Details for d2qtva5

PDB Entry: 2qtv (more details), 2.5 Å

PDB Description: structure of sec23-sar1 complexed with the active fragment of sec31
PDB Compounds: (A:) protein transport protein SEC23

SCOPe Domain Sequences for d2qtva5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtva5 g.41.10.1 (A:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnlsqenmple
lqsttieyitnkpvt

SCOPe Domain Coordinates for d2qtva5:

Click to download the PDB-style file with coordinates for d2qtva5.
(The format of our PDB-style files is described here.)

Timeline for d2qtva5: