Lineage for d2qtva4 (2qtv A:627-768)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534494Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) (S)
  5. 2534495Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins)
  6. 2534496Protein Sec23 [82756] (1 species)
  7. 2534497Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82757] (3 PDB entries)
  8. 2534501Domain d2qtva4: 2qtv A:627-768 [151360]
    Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva3, d2qtva5, d2qtvb_
    automatically matched to d1m2va4
    complexed with gnp, mg, zn

Details for d2qtva4

PDB Entry: 2qtv (more details), 2.5 Å

PDB Description: structure of sec23-sar1 complexed with the active fragment of sec31
PDB Compounds: (A:) protein transport protein SEC23

SCOPe Domain Sequences for d2qtva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtva4 d.109.2.1 (A:627-768) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad
fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpsdnyqdmarggstivl
tddvslqnfmthlqqvavsgqa

SCOPe Domain Coordinates for d2qtva4:

Click to download the PDB-style file with coordinates for d2qtva4.
(The format of our PDB-style files is described here.)

Timeline for d2qtva4: