Class a: All alpha proteins [46456] (202 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (20 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (148 PDB entries) |
Domain d1cpwa_: 1cpw A: [15136] complexed with hem, mto, so4; mutant |
PDB Entry: 1cpw (more details), 2.2 Å
SCOP Domain Sequences for d1cpwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpwa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)} mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikywefiseaiihvlhsrh pgnfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d1cpwa_: