Lineage for d1cpwa_ (1cpw A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries) 
Domain d1cpwa_: 1cpw A: [15136]
Details for d1cpwa_
PDB Entry: 1cpw (more details), 2.2 Å
PDB Description: recombinant sperm whale myoglobin l104w mutant (met)
SCOP Domain Sequences for d1cpwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpwa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikywefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg
SCOP Domain Coordinates for d1cpwa_:
Click to download the PDB-style file with coordinates for d1cpwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cpwa_:
- d1cpwa_ appears in SCOP 1.57
- d1cpwa_ appears in the current release, SCOPe 2.08
View in 3D