Lineage for d2qtva3 (2qtv A:120-390)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128912Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128913Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2129081Family c.62.1.2: Trunk domain of Sec23/24 [82458] (2 protein domains)
    automatically mapped to Pfam PF04811
  6. 2129082Protein Sec23 [82459] (1 species)
  7. 2129083Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82460] (3 PDB entries)
  8. 2129084Domain d2qtva3: 2qtv A:120-390 [151359]
    Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva4, d2qtva5, d2qtvb_
    automatically matched to d1m2oa3
    complexed with gnp, mg, zn

Details for d2qtva3

PDB Entry: 2qtv (more details), 2.5 Å

PDB Description: structure of sec23-sar1 complexed with the active fragment of sec31
PDB Compounds: (A:) protein transport protein SEC23

SCOPe Domain Sequences for d2qtva3:

Sequence, based on SEQRES records: (download)

>d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vppifffvvdltsetenldslkesiitslsllppnaliglitygnvvqlhdlssetidrc
nvfrgdreyqlealtemltgqkptgpggaashlpnamnkvtpfslnrfflpleqvefkln
qllenlspdqwsvpaghrplratgsalniaslllqgcyknipariilfasgpgtvapgli
vnselkdplrshhdidsdhaqhykkackfynqiaqrvaanghtvdifagcydqigmsemk
qltdstggvllltdafstaifkqsylrlfak

Sequence, based on observed residues (ATOM records): (download)

>d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vppifffvvdltsetenldslkesiitslsllppnaliglitygnvvqlhdlssetidrc
nvfrgdreyqlealtemltgqkvtpfslnrfflpleqvefklnqllenlspdqwsvpagh
rplratgsalniaslllqgcyknipariilfasgpgtvapglivnselkdplrshhdids
dhaqhykkackfynqiaqrvaanghtvdifagcydqigmsemkqltdstggvllltdafs
taifkqsylrlfak

SCOPe Domain Coordinates for d2qtva3:

Click to download the PDB-style file with coordinates for d2qtva3.
(The format of our PDB-style files is described here.)

Timeline for d2qtva3: