Lineage for d2qtva2 (2qtv A:2-44,A:391-523)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1772636Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family) (S)
  5. 1772637Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 proteins)
  6. 1772638Protein Sec23 [81997] (1 species)
  7. 1772639Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81998] (3 PDB entries)
  8. 1772640Domain d2qtva2: 2qtv A:2-44,A:391-523 [151358]
    Other proteins in same PDB: d2qtva1, d2qtva3, d2qtva4, d2qtva5, d2qtvb_
    automatically matched to d1m2oa2
    complexed with gnp, mg, zn

Details for d2qtva2

PDB Entry: 2qtv (more details), 2.5 Å

PDB Description: structure of sec23-sar1 complexed with the active fragment of sec31
PDB Compounds: (A:) protein transport protein SEC23

SCOPe Domain Sequences for d2qtva2:

Sequence, based on SEQRES records: (download)

>d2qtva2 b.2.8.1 (A:2-44,A:391-523) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfetnedingvrftwnvfpstrsdansnvvpvgclytplkeydXdeegylkmafngnmav
ktskdlkvqglighasavkktdanniseseigigatstwkmaslspyhsyaiffeianta
ansnpmmsapgsadrphlaytqfittyqhssgtnrirvttvanqllpfgtpaiaasf

Sequence, based on observed residues (ATOM records): (download)

>d2qtva2 b.2.8.1 (A:2-44,A:391-523) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dfetnedingvrftwnvfpstrsdansnvvpvgclytplkeydXdeegylkmafngnmav
ktskdlkvqglighasavkktdanniseseigigatstwkmaslspyhsyaiffeianth
laytqfittyqhssgtnrirvttvanqllpfgtpaiaasf

SCOPe Domain Coordinates for d2qtva2:

Click to download the PDB-style file with coordinates for d2qtva2.
(The format of our PDB-style files is described here.)

Timeline for d2qtva2: