SCOPe 2.08: Domain d2qtva1: 2qtv A:524-626

Lineage for d2qtva1 (2qtv A:524-626)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
   5 helices; bundle

4. Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family)
   automatically mapped to Pfam PF04815

5. Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins)

6. Protein Sec23 [81813] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81814] (3 PDB entries)

8. Domain d2qtva1: 2qtv A:524-626 [151357]
   Other proteins in same PDB: d2qtva2, d2qtva3, d2qtva4, d2qtva5, d2qtvb_
   automatically matched to d1m2oa1
   complexed with gnp, mg, zn

Details for d2qtva1

PDB Entry: 2qtv, 2.5 Å

PDB Description: structure of sec23-sar1 complexed with the active fragment of sec31

PDB Compounds: (A:) protein transport protein SEC23

SCOPe Domain Sequences for d2qtva1:

Sequence; same for both SEQRES and ATOM records:

>d2qtva1 a.71.2.1 (A:524-626) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqeaaavlmariavhkaetddgadvirwldrtliklcqkyadynkddpqsfrlapnfsly
pqftyylrrsqflsvfnnspdetafyrhiftredttnslimiq

Timeline for d2qtva1:

• d2qtva1 first appeared in SCOP 1.75
  
• d2qtva1 appears in SCOPe 2.07