SCOP 1.75: Domain d2qtod1: 2qto D:23-119

Lineage for d2qtod1 (2qto D:23-119)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (2 PDB entries)

8. Domain d2qtod1: 2qto D:23-119 [151353]
   automatically matched to d1k4cc_
   complexed with k

Details for d2qtod1

PDB Entry: 2qto, 3.2 Å

PDB Description: an anisotropic model for potassium channel kcsa

PDB Compounds: (D:) Voltage-gated potassium channel

SCOP Domain Sequences for d2qtod1:

Sequence; same for both SEQRES and ATOM records:

>d2qtod1 f.14.1.1 (D:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

Timeline for d2qtod1:

• d2qtod1 is new in SCOP 1.75
  
• d2qtod1 appears in SCOPe 2.01
  
• d2qtod1 appears in the current release, SCOPe 2.08