Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (2 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries) |
Domain d2qtoc1: 2qto C:23-119 [151352] automatically matched to d1k4cc_ complexed with k |
PDB Entry: 2qto (more details), 3.2 Å
SCOPe Domain Sequences for d2qtoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qtoc1 f.14.1.1 (C:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
Timeline for d2qtoc1: