Lineage for d2qtob1 (2qto B:23-119)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956602Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 1956603Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1956604Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1956625Protein Potassium channel protein [56901] (2 species)
  7. 1956665Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries)
  8. 1956685Domain d2qtob1: 2qto B:23-119 [151351]
    automatically matched to d1k4cc_
    complexed with k

Details for d2qtob1

PDB Entry: 2qto (more details), 3.2 Å

PDB Description: an anisotropic model for potassium channel kcsa
PDB Compounds: (B:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2qtob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtob1 f.14.1.1 (B:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOPe Domain Coordinates for d2qtob1:

Click to download the PDB-style file with coordinates for d2qtob1.
(The format of our PDB-style files is described here.)

Timeline for d2qtob1: