![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (2 species) |
![]() | Species Streptomyces lividans [TaxId:1916] [161074] (2 PDB entries) |
![]() | Domain d2qtob1: 2qto B:23-119 [151351] automatically matched to d1k4cc_ complexed with k |
PDB Entry: 2qto (more details), 3.2 Å
SCOPe Domain Sequences for d2qtob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qtob1 f.14.1.1 (B:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
Timeline for d2qtob1: