Lineage for d2qtob1 (2qto B:23-119)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023620Protein Potassium channel protein [56901] (3 species)
  7. 3023663Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries)
  8. 3023698Domain d2qtob1: 2qto B:23-119 [151351]
    automatically matched to d1k4cc_
    complexed with k

Details for d2qtob1

PDB Entry: 2qto (more details), 3.2 Å

PDB Description: an anisotropic model for potassium channel kcsa
PDB Compounds: (B:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2qtob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtob1 f.14.1.1 (B:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOPe Domain Coordinates for d2qtob1:

Click to download the PDB-style file with coordinates for d2qtob1.
(The format of our PDB-style files is described here.)

Timeline for d2qtob1: