SCOPe 2.01: Domain d2qtoa1: 2qto A:23-119

Lineage for d2qtoa1 (2qto A:23-119)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (2 PDB entries)

8. Domain d2qtoa1: 2qto A:23-119 [151350]
   automatically matched to d1k4cc_
   complexed with k

Details for d2qtoa1

PDB Entry: 2qto, 3.2 Å

PDB Description: an anisotropic model for potassium channel kcsa

PDB Compounds: (A:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2qtoa1:

Sequence; same for both SEQRES and ATOM records:

>d2qtoa1 f.14.1.1 (A:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

Timeline for d2qtoa1:

• d2qtoa1 first appeared in SCOP 1.75
  
• d2qtoa1 appears in SCOPe 2.02
  
• d2qtoa1 appears in the current release, SCOPe 2.08