Lineage for d2qtoa1 (2qto A:23-119)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886689Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 886690Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 886691Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)
  6. 886708Protein Potassium channel protein [56901] (2 species)
  7. 886762Species Streptomyces lividans [TaxId:1916] [161074] (2 PDB entries)
  8. 886764Domain d2qtoa1: 2qto A:23-119 [151350]
    automatically matched to d1k4cc_
    complexed with k

Details for d2qtoa1

PDB Entry: 2qto (more details), 3.2 Å

PDB Description: An anisotropic model for potassium channel KcsA
PDB Compounds: (A:) Voltage-gated potassium channel

SCOP Domain Sequences for d2qtoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtoa1 f.14.1.1 (A:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOP Domain Coordinates for d2qtoa1:

Click to download the PDB-style file with coordinates for d2qtoa1.
(The format of our PDB-style files is described here.)

Timeline for d2qtoa1: