Lineage for d2qtoa1 (2qto A:23-119)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577062Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2577083Protein Potassium channel protein [56901] (3 species)
  7. 2577123Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries)
  8. 2577149Domain d2qtoa1: 2qto A:23-119 [151350]
    automatically matched to d1k4cc_
    complexed with k

Details for d2qtoa1

PDB Entry: 2qto (more details), 3.2 Å

PDB Description: An anisotropic model for potassium channel KcsA
PDB Compounds: (A:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2qtoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtoa1 f.14.1.1 (A:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOPe Domain Coordinates for d2qtoa1:

Click to download the PDB-style file with coordinates for d2qtoa1.
(The format of our PDB-style files is described here.)

Timeline for d2qtoa1: