SCOP 1.69: Domain d112m__: 112m -

Lineage for d112m__ (112m -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)

8. Domain d112m__: 112m - [15135]

Details for d112m__

PDB Entry: 112m, 2.34 Å

PDB Description: sperm whale myoglobin d122n n-propyl isocyanide at ph 9.0

SCOP Domain Sequences for d112m__:

Sequence; same for both SEQRES and ATOM records:

>d112m__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d112m__:

• d112m__ first appeared (with stable ids) in SCOP 1.55
  
• d112m__ appears in SCOP 1.67
  
• d112m__ appears in SCOP 1.71
  
• d112m__ appears in the current release, SCOPe 2.08, called d112ma_